Mouse BMP-4 Recombinant Protein (N-His) (active)
- SKU:
- RPES6714
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Frequently bought together:
Description
Product Name: | Mouse BMP-4 Recombinant Protein (N-His) (active) |
Product Code: | RPES6714 |
Size: | 20µg |
Species: | Mouse |
Expression Host: | E.coli |
Synonyms: | interleukin 1 family, member 9, IL-1F9, IL-1ε (epsilon) and IL-1H1 |
Mol Mass: | 47.33 kDa |
Tag: | N-His |
Purity: | > 98 % as determined by reducing SDS-PAGE. |
Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
Bio Activity: | Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 10 ng/mL. The specific activity of recombinant mouse BMP-4 is > 1 x 105IU/mg. |
Sequence: | MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLENIPGTSESSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Accession: | P21275 |
Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
Formulation: | Lyophilized from a solution containing 20 mM sodium carbonate, pH 4.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
Reconstitution: | Please refer to the printed manual for detailed information. |
Background: | Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including neurogenesis, vascular development, angiogenesis and osteogenesis. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface, BMPR2 phosphorylates and activates BMPR1A. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK/MAP kinase, PI3K/Akt or SRC cascades. For example, induces SRC phosphorylation which, in turn, activates VEGFR2, leading to an angiogenic response. |