Human OTOR Recombinant Protein (RPPB0829)
- SKU:
- RPPB0829
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- Q9NRC9
- Research Area:
- Cytokines
Description
| Product Name: | Human OTOR Recombinant Protein |
| Product Code: | RPPB0829 |
| Size: | 20µg |
| Species: | Human |
| Target: | OTOR |
| Synonyms: | Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 130mM NaCl. |
| Solubility: | It is recommended to reconstitute the lyophilized Otoraplin in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE |
OTOR proteins is also known as fibrocyte-derived protein (Fdp) and Melanoma inhibitory activity-like (MIAL). Otoraplin is a member of the melanoma-inhibiting activity gene family. Otoraplin is a secreted 16 kDa globular protein that is expressed in the inner ear by periotic mesenchyme and developing and mature fibrocytes. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46 � 107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes pasrt in the initiation of periotic mesenchyme chondrogenesis. Otoraplin is secreted through the Golgi apparatus and plays a role in cartilage development and maintenance. A frequent polymorphism in the translation start codon of OTOR can abolish translation and may be associated with forms of deafness.
Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.The OTOR is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | OTOR: is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. This gene is a member of the melanoma-inhibiting activity gene family. In addition, alternate polyA sites exist for this gene. [provided by RefSeq, Jul 2008] |
| UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide Chromosomal Location of Human Ortholog: 20p12.1-p11.23 Cellular Component: extracellular region Biological Process: sensory perception of sound; cartilage condensation |
| NCBI Summary: | This gene encodes a member of the melanoma-inhibiting activity gene family. The encoded protein is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. [provided by RefSeq, Jul 2013] |
| UniProt Code: | Q9NRC9 |
| NCBI GenInfo Identifier: | 13124388 |
| NCBI Gene ID: | 56914 |
| NCBI Accession: | Q9NRC9.1 |
| UniProt Secondary Accession: | Q9NRC9,Q3MIU6, D3DW22, |
| UniProt Related Accession: | Q9NRC9 |
| Molecular Weight: | 14,332 Da |
| NCBI Full Name: | Otoraplin |
| NCBI Synonym Full Names: | otoraplin |
| NCBI Official Symbol: | OTOR�� |
| NCBI Official Synonym Symbols: | FDP; MIAL1�� |
| NCBI Protein Information: | otoraplin; fibrocyte-derived protein; melanoma inhibitory activity-like protein |
| UniProt Protein Name: | Otoraplin |
| UniProt Synonym Protein Names: | Fibrocyte-derived protein; Melanoma inhibitory activity-like protein |
| Protein Family: | Otoraplin |
| UniProt Gene Name: | OTOR�� |
| UniProt Entry Name: | OTOR_HUMAN |
Related Products
Human Recombinant Protein S100P Recombinant Protein (His Tag) (RPES6517)
Human Recombinant Protein S100P Recombinant Protein (His Tag) (RPES5309)
