Human IL-12 p40 Recombinant Protein (N-His) (active)
- SKU:
- RPES6499
- Product Type:
- Recombinant Protein
- Species:
- Human
Frequently bought together:
Description
Product Name: | Human IL-12 p40 Recombinant Protein (N-His) (active) |
Product Code: | RPES6499 |
Size: | 20µg |
Species: | Human |
Expression Host: | E.coli |
Synonyms: | Interleukin-12 subunit beta, IL-12 subunit p40, IL-12B, Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40), NK cell Stimulating Factor Chain 2 |
Mol Mass: | 38.00 kDa |
Tag: | N-His |
Purity: | > 98 % as determined by reducing SDS-PAGE. |
Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
Bio Activity: | Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is < 88 pg/mL. |
Sequence: | MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Accession: | P29460 |
Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
Reconstitution: | Please refer to the printed manual for detailed information. |
Background: | Interleukin-12 subunit beta (IL-12B) belongs to the type I cytokine receptor family. It contains 1 fibronectin type-III domain and 1 Ig-like C2-type domain. IL-12B is a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. IL-12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor encoded by IL12B and a 35 kD subunit encoded by IL12A. IL12 is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. It has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. |