WNV Pre-M Recombinant Protein (RPPB5677)
- SKU:
- RPPB5677
- Product Type:
- Recombinant Protein
- Species:
- Viral
Description
Product Name: | WNV Pre-M Recombinant Protein |
Product Code: | RPPB5677 |
Size: | 0.5mg |
Species: | WNV |
Target: | Pre-M |
Source: | Escherichia Coli |
Formulation: | 20mM phosphate buffer pH 7.5. |
Stability: | WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
Purity: | Protein is >95% pure as determined by SDS-PAGE. |
Amino Acid Sequence: | MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE |
West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.
The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag at c-terminal.