null

α-Tubulin Rabbit Polyclonal Antibody (CABC007)

SKU:
CABC007
€109
Frequently bought together:

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:α-Tubulin Rabbit Polyclonal Antibody
SKU:CABC007
Size:100uL
Isotype:IgG
Host Species:Rabbit
Reactivity:Human,Mouse,Rat
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human α-Tubulin (NP_005991.1).
Sequence:MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
Tested Applications:WB IF/ICC
Recommended Dilution:WB,1:500 - 1:1000 IF/ICC,1:50 - 1:200
Synonyms:ALS22; TUBA1; H2-ALPHA; α-Tubulin
Positive Sample:A-431,HeLa,K-562,Mouse kidney,Mouse brain
Conjugate:Unconjugated
Cellular Localization:Cytoplasm, cytoskeleton.
Calculated MW:50kDa
Observed MW:55kDa

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene encodes an alpha tubulin that is a highly conserved homolog of a rat testis-specific alpha tubulin. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Purification Method:Affinity purification
Gene ID:7277
Storage Buffer:Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300,50% glycerol,pH7.3.
Product ImageWestern blot analysis of various lysates using α-Tubulin Rabbit pAb (AC007) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (AbGn00020).Exposure time: 1s.

Related Products