Streptavidin Recombinant Protein (RPPB4856)
- SKU:
- RPPB4856
- Product Type:
- Recombinant Protein
- Uniprot:
- P22629
Description
| Product Name: | Streptavidin Recombinant Protein |
| Product Code: | RPPB4856 |
| Size: | 20mg |
| Target: | Streptavidin |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | Lyophilized in 10mM potassium phosphate buffer pH 6.5. |
| Solubility: | It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M?-cm H2O not less than 0.5mg/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Streptavidin is shipped at ambient temperature, upon arrival store at -20°C. |
| Purity: | Greater than 98.0% as determined by SDS-PAGE and HPLC. |
| Amino Acid Sequence: | MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS |
Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.
Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa.
| UniProt Protein Function: | streptavidin: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). (organism: Streptomyces avidinii) |
| UniProt Protein Details: | |
| NCBI Summary: | |
| UniProt Code: | P22629 |
| NCBI GenInfo Identifier: | 134951 |
| NCBI Gene ID: | |
| NCBI Accession: | P22629.1 |
| UniProt Secondary Accession: | P22629 |
| UniProt Related Accession: | P22629 |
| Molecular Weight: | |
| NCBI Full Name: | Streptavidin |
| NCBI Synonym Full Names: | |
| NCBI Official Symbol: | |
| NCBI Official Synonym Symbols: | |
| NCBI Protein Information: | |
| UniProt Protein Name: | Streptavidin |
| UniProt Synonym Protein Names: | |
| Protein Family: | Streptavidin |
| UniProt Gene Name: | |
| UniProt Entry Name: | SAV_STRAV |
Related Products
