Pylori Omp Recombinant Protein (RPPB4159)
- SKU:
- RPPB4159
- Product Type:
- Recombinant Protein
- Species:
- Pylori
- Research Area:
- Microbiology
Description
| Product Name: | Pylori Omp Recombinant Protein |
| Product Code: | RPPB4159 |
| Size: | 0.5mg |
| Species: | Pylori |
| Target: | Omp |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile filtered liquid formulation. |
| Formulation: | The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4. |
| Stability: | Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
| Purity: | Greater than 95% pure as determined by 12% PAGE (Coomassie staining). |
| Amino Acid Sequence: | MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL |
Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world's population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection.
Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Related Products
