Porcine Trypsin Recombinant Protein (RPPB5024)
- SKU:
- RPPB5024
- Product Type:
- Recombinant Protein
- Species:
- Pig
Description
| Product Name: | Porcine Trypsin Recombinant Protein |
| Product Code: | RPPB5024 |
| Size: | 2.5mg |
| Species: | Porcine |
| Target: | Trypsin |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered lyophilized powder. |
| Formulation: | The Porcine Trypsin was lyophilized with mannitol as preservative. |
| Solubility: | It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Amino Acid Sequence: | VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN |
| Biological Activity: | 4500 USP units/mg protein. |
Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-?-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.
Related Products
