Mouse IL-17F Recombinant Protein (N-His) (active)
- SKU:
- RPES6690
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Frequently bought together:
Description
Product Name: | Mouse IL-17F Recombinant Protein (N-His) (active) |
Product Code: | RPES6690 |
Size: | 20µg |
Species: | Mouse |
Expression Host: | E.coli |
Synonyms: | Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL17F, IL24 |
Mol Mass: | 18.77 kDa |
Tag: | N-His |
Purity: | > 98 % as determined by reducing SDS-PAGE. |
Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
Bio Activity: | Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 100 ng/mL. |
Sequence: | MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA |
Accession: | Q7TNI7 |
Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
Formulation: | Lyophilized from a solution containing 20 mM sodium citrate, pH 4.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
Reconstitution: | Please refer to the printed manual for detailed information. |
Background: | Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. Today; IL-17 represents a family of structurally related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family; IL-17A through IL-17F; are secreted as homodimers. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis. |