null

Mouse CXCL10 Recombinant Protein (N-His) (active)

SKU:
RPES6726
Product Type:
Recombinant Protein
Species:
Mouse
€369
Frequently bought together:

Description

Product Name:Mouse CXCL10 Recombinant Protein (N-His) (active)
Product Code:RPES6726
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:IFNB1, Type I Interferon
Mol Mass:8.7 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is < 0.2 μg/mL.
Sequence:IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Accession:P17515
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types; such as monocytes; endothelial cells and fibroblasts; in response to IFN-γ. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles; such as chemoattraction for activated T-lymphocytes; inhibition of angiogenesis; and antitumor activity.

Related Products