null

mCherry Rabbit Polyclonal Antibody (CABE171)

SKU:
CABE171
€199
Frequently bought together:

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:mCherry Rabbit Polyclonal Antibody
SKU:CABE171
Size:100uL
Isotype:IgG
Host Species:Rabbit
Reactivity:Species independent
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-236 of mCherry tag.
Sequence:MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Tested Applications:WB ELISA
Recommended Dilution:WB,1:2000 - 1:10000
Synonyms:mCherry; mCherry tag; mCherry-tag
Positive Sample:293F transfected with CT55-mCherry
Conjugate:Unconjugated
Observed MW:55kDa

Protein tags are peptide sequences genetically grafted onto a recombinant protein. Often these tags are removable by chemical agents or by enzymatic means, such as proteolysis or intein splicing. Tags are attached to proteins for various purposes.Epitope tags are short peptide sequences which are chosen because high-affinity antibodies can be reliably produced in many different species. These are usually derived from viral genes, which explain their high immunoreactivity. Epitope tags include V5-tag, Myc-tag, HA-tag and NE-tag. These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, although they also find use in antibody purification.

Purification Method:Affinity purification
Storage Buffer:Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300,50% glycerol,pH7.3.
Product ImageWestern blot analysis of lysates from wild type (WT) and 293F cells transfected with CT55-mCherry using mCherry Rabbit pAb(AE171) at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (AbGn00020).Exposure time: 1s.

Related Products