Human OSM Recombinant Protein (RPPB0823)
- SKU:
- RPPB0823
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P13725
- Research Area:
- Growth Factors & Cytokines
Description
Product Name: | Human OSM Recombinant Protein |
Product Code: | RPPB0823 |
Size: | 10µg |
Species: | Human |
Target: | OSM |
Synonyms: | OSM, MGC20461, Oncostatin M. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH-7.4. |
Solubility: | It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR |
Biological Activity: | The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is < 2 ng/ml, corresponding to a Specific Activity of 500,000 IU/mg. |
Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells.
Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa. The Oncostatin-M (209 a.a.) is purified by proprietary chromatographic techniques.
UniProt Protein Function: | OSM: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. Belongs to the LIF/OSM family. |
UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide; Cytokine Chromosomal Location of Human Ortholog: 22q12.2 Cellular Component: extracellular space Molecular Function:growth factor activity; oncostatin-M receptor binding; cytokine activity Biological Process: negative regulation of hormone secretion; multicellular organismal development; tyrosine phosphorylation of Stat3 protein; positive regulation of peptidyl-serine phosphorylation; tyrosine phosphorylation of Stat5 protein; peripheral nervous system development; cell proliferation; negative regulation of cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; behavioral response to pain; positive regulation of MAPKKK cascade; positive regulation of acute inflammatory response; response to heat; positive regulation of cell division; regulation of growth; positive regulation of cell proliferation; negative regulation of meiosis; tyrosine phosphorylation of Stat1 protein; positive regulation of transcription from RNA polymerase II promoter; immune response |
NCBI Summary: | Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. [provided by RefSeq, Jul 2008] |
UniProt Code: | P13725 |
NCBI GenInfo Identifier: | 129168 |
NCBI Gene ID: | 5008 |
NCBI Accession: | P13725.2 |
UniProt Secondary Accession: | P13725,Q6FHP8, Q9UCP6, |
UniProt Related Accession: | P13725 |
Molecular Weight: | 28,484 Da |
NCBI Full Name: | Oncostatin-M |
NCBI Synonym Full Names: | oncostatin M |
NCBI Official Symbol: | OSM�� |
NCBI Protein Information: | oncostatin-M |
UniProt Protein Name: | Oncostatin-M |
Protein Family: | Oncostatin |
UniProt Gene Name: | OSM�� |
UniProt Entry Name: | ONCM_HUMAN |