Description
Product Name: | Human MIF His C Recombinant Protein |
Product Code: | RPPB0762 |
Size: | 25µg |
Species: | Human |
Target: | MIF His C |
Synonyms: | Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered lyophilized powder. |
Formulation: | Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4. |
Solubility: | It is recommended to reconstitute the lyophilized MIF in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH |
Biological Activity: | Measured by its ability to bind rhCD74 in a functional ELISA. |
The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.
MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.
UniProt Protein Function: | MIF: a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. Also acts as a phenylpyruvate tautomerase. |
UniProt Protein Details: | Protein type:EC 5.3.2.1; Isomerase; EC 5.3.3.12; Amino Acid Metabolism - tyrosine; Cell development/differentiation; Cytokine; Apoptosis; Amino Acid Metabolism - phenylalanine Chromosomal Location of Human Ortholog: 22q11.23 Cellular Component: cell surface; cytoplasm; extracellular region; extracellular space; myelin sheath; nucleoplasm; vesicle Molecular Function:chemoattractant activity; cytokine activity; dopachrome isomerase activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; phenylpyruvate tautomerase activity; protein binding; receptor binding Biological Process: blood coagulation; carboxylic acid metabolic process; cell aging; cell proliferation; cell surface receptor linked signal transduction; DNA damage response, signal transduction by p53 class mediator; inflammatory response; innate immune response; leukocyte migration; negative regulation of apoptosis; negative regulation of cellular protein metabolic process; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of mature B cell apoptosis; negative regulation of myeloid cell apoptosis; positive chemotaxis; positive regulation of B cell proliferation; positive regulation of cytokine secretion; positive regulation of fibroblast proliferation; positive regulation of lipopolysaccharide-mediated signaling pathway; positive regulation of MAP kinase activity; positive regulation of peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of phosphorylation; prostaglandin biosynthetic process; regulation of macrophage activation Disease: Rheumatoid Arthritis, Systemic Juvenile |
NCBI Summary: | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008] |
UniProt Code: | P14174 |
NCBI GenInfo Identifier: | 1170955 |
NCBI Gene ID: | 4282 |
NCBI Accession: | P14174.4 |
UniProt Secondary Accession: | P14174,Q2V4Y5, Q6FHV0, A5Z1R8, B2R4S3, |
UniProt Related Accession: | P14174 |
Molecular Weight: | 12,476 Da |
NCBI Full Name: | Macrophage migration inhibitory factor |
NCBI Synonym Full Names: | macrophage migration inhibitory factor (glycosylation-inhibiting factor) |
NCBI Official Symbol: | MIF�� |
NCBI Official Synonym Symbols: | GIF; GLIF; MMIF�� |
NCBI Protein Information: | macrophage migration inhibitory factor |
UniProt Protein Name: | Macrophage migration inhibitory factor |
UniProt Synonym Protein Names: | Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase (EC:5.3.3.12); Phenylpyruvate tautomerase |
Protein Family: | MIF-like protein |
UniProt Gene Name: | MIF�� |
UniProt Entry Name: | MIF_HUMAN |