Description
Product Name: | Human LGALS7 Recombinant Protein |
Product Code: | RPPB0284 |
Size: | 10µg |
Species: | Human |
Target: | LGALS7 |
Synonyms: | Galectin-7, Gal-7, HKL-14, PI7, p53-induced gene 1 protein, LGALS7, PIG1, LGALS7B, GAL7, LGALS7A. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | LGALS7 was lyophilized from a concentrated (1mg/ml) solution in�20mM Tris, 150mM NaCl, 1mM EDTA and 5% Trehalose, pH 8. |
Solubility: | It is recommended to reconstitute the lyophilized Galectin-7 in sterile�distilled H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized LGALS7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Galectin-7 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
Purity: | Greater than 95.0% as determined by SDS-PAGE. |
Amino Acid Sequence: | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
Galectins are a family of animal lectins with an affinity for beta-galactosides. This family has at least 14 identified members. Galectins share similarities in the CRD (the carbohydrate recognition domain). Galectins are synthesized as cytosolic proteins. Though localized principally in the cytoplasm and lacking a classical signal peptide, galectins can also be stimulated to secretion by non-classical pathways or alternatively targeted to the nucleus. Galectins are involved in modulating cell-cell and cell-matrix interactions. Human Galectin-7 belongs to the prototypical Galectins containing a single CRD, which is initially identified in human epidermis as a monomer. The Galectin-7 expression is induced by tumor suppressor protein p53 and associated with apoptosis. Galectin-7 is a pro-apoptotic protein which functions intracellularlly upstream of JNK activation and mitochondrial cytochrome c release. The correlation of Galectin-7 with the UV-induced apoptosis of keratinocytes presents a critical mechanism in the maintenance of epidermal homeostasis. Human Galectin-7 is localized in both nucleus and cytoplasm.
Galectin-7 Human Recombinant produced in E.Coli is a single,�non-glycosylated, Polypeptide chain containing 136 amino acids and having a molecular mass of 15kDa.The LGALS7 is purified by proprietary chromatographic techniques.
UniProt Protein Function: | LGALS7B: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. |
UniProt Protein Details: | Protein type:Apoptosis; Cell adhesion Chromosomal Location of Human Ortholog: 19q13.2 Cellular Component: cytoplasm; extracellular space; nucleus Molecular Function:carbohydrate binding Biological Process: apoptosis; heterophilic cell adhesion |
NCBI Summary: | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:3963) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008] |
UniProt Code: | P47929 |
NCBI GenInfo Identifier: | 1346431 |
NCBI Gene ID: | 653499 |
NCBI Accession: | P47929.2 |
UniProt Secondary Accession: | P47929,Q6IB87, |
UniProt Related Accession: | P47929 |
Molecular Weight: | 15,075 Da |
NCBI Full Name: | Galectin-7 |
NCBI Synonym Full Names: | lectin, galactoside binding soluble 7B |
NCBI Official Symbol: | LGALS7B�� |
NCBI Official Synonym Symbols: | PI7; GAL7; Gal-7; HKL-14; LGALS7�� |
NCBI Protein Information: | galectin-7 |
UniProt Protein Name: | Galectin-7 |
UniProt Synonym Protein Names: | HKL-14; PI7; p53-induced gene 1 protein |
Protein Family: | Galectin |
UniProt Gene Name: | LGALS7�� |
UniProt Entry Name: | LEG7_HUMAN |