Human IP 10 Recombinant Protein (RPPB1170)
- SKU:
- RPPB1170
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P02778
- Research Area:
- Chemokines
Description
| Product Name: | Human IP 10 Recombinant Protein |
| Product Code: | RPPB1170 |
| Size: | 25µg |
| Species: | Human |
| Target: | IP 10 |
| Synonyms: | Small inducible cytokine B10, CXCL10, 10 kDa, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Solubility: | It is recommended to reconstitute the lyophilized IP-10 in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP |
Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family. CXCL10 is secreted by several cell types in response to IFN. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.
IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | CXCL10: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family. |
| UniProt Protein Details: | Protein type:Chemokine; Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted Chromosomal Location of Human Ortholog: 4q21 Cellular Component: extracellular space; extracellular region; external side of plasma membrane Molecular Function:heparin binding; protein binding; CXCR3 chemokine receptor binding; chemokine activity; cAMP-dependent protein kinase regulator activity; receptor binding Biological Process: muscle development; blood circulation; protein secretion; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; signal transduction; chemotaxis; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; response to vitamin D; cell surface receptor linked signal transduction; cell-cell signaling; positive regulation of cell proliferation; response to gamma radiation; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of release of sequestered calcium ion into cytosol; response to cold; negative regulation of myoblast differentiation; inflammatory response; regulation of protein kinase activity; defense response to virus |
| NCBI Summary: | This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Sep 2014] |
| UniProt Code: | P02778 |
| NCBI GenInfo Identifier: | 21542456 |
| NCBI Gene ID: | 3627 |
| NCBI Accession: | P02778.2 |
| UniProt Secondary Accession: | P02778,Q96QJ5, |
| UniProt Related Accession: | P02778 |
| Molecular Weight: | 10,881 Da |
| NCBI Full Name: | C-X-C motif chemokine 10 |
| NCBI Synonym Full Names: | chemokine (C-X-C motif) ligand 10 |
| NCBI Official Symbol: | CXCL10�� |
| NCBI Official Synonym Symbols: | C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10�� |
| NCBI Protein Information: | C-X-C motif chemokine 10; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10 |
| UniProt Protein Name: | C-X-C motif chemokine 10 |
| UniProt Synonym Protein Names: | 10 kDa interferon gamma-induced protein; Gamma-IP10; IP-10; Small-inducible cytokine B10Cleaved into the following chain:CXCL10(1-73) |
| UniProt Gene Name: | CXCL10�� |
| UniProt Entry Name: | CXL10_HUMAN |
Related Products
