Human IL 13 Recombinant Protein (RPPB0574)
- SKU:
- RPPB0574
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P35225
- Research Area:
- Cytokines
Description
Product Name: | Human IL 13 Recombinant Protein |
Product Code: | RPPB0574 |
Size: | 10µg |
Species: | Human |
Target: | IL 13 |
Synonyms: | NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose. |
Solubility: | It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 95% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Biological Activity: | The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be < 1ng/ml, corresponding to a specific activity of >1 x 106units/mg. |
IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL-13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.
UniProt Protein Function: | IL13: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Defects in IL13 may be a cause of susceptibility to allergic rhinitis (ALRH). Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure. Belongs to the IL-4/IL-13 family. |
UniProt Protein Details: | Protein type:Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted Chromosomal Location of Human Ortholog: 5q31 Cellular Component: extracellular region; extracellular space Molecular Function:interleukin-13 receptor binding; protein binding Biological Process: cell motility; cell-cell signaling; positive regulation of B cell proliferation; positive regulation of immunoglobulin production; positive regulation of macrophage activation; positive regulation of mast cell degranulation Disease: Allergic Rhinitis; Asthma, Susceptibility To |
NCBI Summary: | This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008] |
UniProt Code: | P35225 |
NCBI GenInfo Identifier: | 239938644 |
NCBI Gene ID: | 3596 |
NCBI Accession: | P35225.2 |
UniProt Secondary Accession: | P35225,O43644, Q4VB52, Q9UDC7, |
UniProt Related Accession: | P35225 |
Molecular Weight: | 15,816 Da |
NCBI Full Name: | Interleukin-13 |
NCBI Synonym Full Names: | interleukin 13 |
NCBI Official Symbol: | IL13�� |
NCBI Official Synonym Symbols: | P600; IL-13�� |
NCBI Protein Information: | interleukin-13 |
UniProt Protein Name: | Interleukin-13 |
Protein Family: | Interleukin |
UniProt Gene Name: | IL13�� |
UniProt Entry Name: | IL13_HUMAN |