null

Human GNLY Recombinant Protein (RPPB3625)

SKU:
RPPB3625
Product Type:
Recombinant Protein
Species:
Human
Uniprot:
P22749
€309
Frequently bought together:

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Human GNLY Recombinant Protein
Product Code:RPPB3625
Size:10µg
Species:Human
Target:GNLY
Synonyms:LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.
Source:Escherichia Coli
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Solubility:It is recommended to reconstitute the lyophilized Granulysin in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions.
Stability:Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity:Greater than 95.0% as determined by SDS-PAGE.
Amino Acid Sequence:MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH

GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.

GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary chromatographic techniques.

UniProt Protein Function:GNLY: Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: extracellular space

Biological Process: killing of cells of another organism; defense response to bacterium; cellular defense response; defense response to fungus

NCBI Summary:The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
UniProt Code:P22749
NCBI GenInfo Identifier:116242500
NCBI Gene ID:10578
NCBI Accession:P22749.3
UniProt Secondary Accession:P22749,P09325, Q6GU08,
UniProt Related Accession:P22749
Molecular Weight:14,853 Da
NCBI Full Name:Granulysin
NCBI Synonym Full Names:granulysin
NCBI Official Symbol:GNLY��
NCBI Official Synonym Symbols:519; LAG2; NKG5; LAG-2; D2S69E; TLA519��
NCBI Protein Information:granulysin; lymphokine LAG-2; lymphocyte-activation gene 2; T-cell activation protein 519; T-lymphocyte activation gene 519
UniProt Protein Name:Granulysin
UniProt Synonym Protein Names:Lymphokine LAG-2; Protein NKG5; T-cell activation protein 519
Protein Family:Granulysin
UniProt Gene Name:GNLY��
UniProt Entry Name:GNLY_HUMAN

Related Products