Description
Product Name: | Human FSH Recombinant Protein |
Product Code: | RPPB1274 |
Size: | 10µg |
Species: | Human |
Target: | FSH |
Synonyms: | Follitropin subunit beta, Follicle-stimulating hormone beta subunit, FSH-beta, FSH-B, Follitropin beta chain, FSH. |
Source: | HEK293 Cells |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | The recombinant FSH was lyophilized from 0.2�m filtered solution containing PBS, pH 7.4. |
Solubility: | It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18M?-cm H2O not less than 100 �g/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 95% as determined by SDS-PAGE. |
Amino Acid Sequence: | FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
Biological Activity: | The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml. |
Follicle stimulating hormone (FSH) is a hormone synthesised and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction: In women, in the ovary FSH stimulates the growth of immature Graafian follicles to maturation. As the follicle grows it releases inhibin, which shuts off the FSH production. In men, FSH enhances the production of androgen-binding protein by the Sertoli cells of the testes and is critical for spermatogenesis. In both males and females, FSH stimulates the maturation of germ cells. In females, FSH initiates follicular growth, specifically affecting granulosa cells. With the concomitant rise in inhibin B FSH levels then decline in the late follicular phase. This seems to be critical in selecting only the most advanced follicle to proceed to ovulation. At the end of the luteal phase, there is a slight rise in FSH that seems to be of importance to start the next ovulatory cycle. Like its partner, LH, FSH release at the pituitary gland is controlled by pulses of gonadotropin-releasing hormone (GnRH). Those pulses, in turn, are subject to the estrogen feed-back from the gonads.
FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Ala25-Ser116) and human FSH-beta chain (Asn19-Glu129) (Accession # P01225) having a total Mw of 38kDa.FSH human recombinant is purified by proprietary chromatographic techniques.
UniProt Protein Function: | FSHB: Stimulates development of follicle and spermatogenesis in the reproductive organs. Defects in FSHB are a cause of isolated follicle- stimulating hormone deficiency (IFSHD). Selective follicle-stimulating hormone deficiency is an uncommon cause of infertility, producing amenorrhea and hypogonadism in women and oligo or azoospermia with normal testosterone levels in normally virilised men. Belongs to the glycoprotein hormones subunit beta family. |
UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide Chromosomal Location of Human Ortholog: 11p13 Cellular Component: cytoplasm; extracellular region Molecular Function:follicle-stimulating hormone activity; hormone activity; protein binding Biological Process: female gamete generation; female pregnancy; peptide hormone processing; progesterone biosynthetic process; signal transduction; transforming growth factor beta receptor signaling pathway Disease: Follicle-stimulating Hormone Deficiency, Isolated |
NCBI Summary: | The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
UniProt Code: | P01225 |
NCBI GenInfo Identifier: | 120552 |
NCBI Gene ID: | 2488 |
NCBI Accession: | P01225.2 |
UniProt Secondary Accession: | P01225,Q14D61, A2TF08, A5JVV3, |
UniProt Related Accession: | P01225 |
Molecular Weight: | 14,700 Da |
NCBI Full Name: | Follitropin subunit beta |
NCBI Synonym Full Names: | follicle stimulating hormone beta subunit |
NCBI Official Symbol: | FSHB�� |
NCBI Official Synonym Symbols: | HH24�� |
NCBI Protein Information: | follitropin subunit beta |
UniProt Protein Name: | Follitropin subunit beta |
UniProt Synonym Protein Names: | Follicle-stimulating hormone beta subunit; FSH-B; FSH-beta; Follitropin beta chain |
Protein Family: | Follitropin |
UniProt Gene Name: | FSHB�� |
UniProt Entry Name: | FSHB_HUMAN |