Human FKBP1A Recombinant Protein (RPPB1639)
- SKU:
- RPPB1639
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P62942
- Research Area:
- Enzymes
Description
| Product Name: | Human FKBP1A Recombinant Protein |
| Product Code: | RPPB1639 |
| Size: | 10µg |
| Species: | Human |
| Target: | FKBP1A |
| Synonyms: | FKBP12, PPIase, Peptidyl-prolyl cis-trans isomerase, Rotamase, FKBP-12, FKBP1, PKC12, PKCI2, FKBP12C, FKBP1A, PPIase FKBP1A, FK506-binding protein 1A, 12 kDa FKBP, FKBP-1A. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered colorless solution. |
| Formulation: | The FKBP1A protein solution contains 50mM Hepes pH-8.0, 150mM NaCl, 0.5mM EDTA & 1mM sodium azide. |
| Stability: | Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Purity: | Greater than 99.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | The amino acid sequence of recombinant His-tagged FKBP12 is reported as following:MAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
FKBP1A is a 12kDa protein initialy discovered onin immune cells on the basis of its capability to bind and mediate the intracellular effect of the immunosuppressant FK506. FKBP1A is also known to mediate the action of Rapamycin-immunosuppressive agent. FKBP1A is part of the family of immunophilins, which have in common high affinity for immunosuppressant drugs and a peptidyl-prolyl cis-trans isomerase (PPIase). Activity which participates in folding of proline-containing protein. In the absence of immunosuppressive ligands, FKBP1A is involved in intracellular calcium regulation by associating with 3 types of Ca2+ release channel complexes: skeletal ryanodine receptors, cardiac ryanodine receptors and the inositol 1,4,5-triphosphate receptor. FKBP1A also interact with TGF-b type I receptor exerting an inhibitory effect on the TGF-b signaling pathway. FKBP12 plays a role in modulation of ryanodine receptor isoform-1 (ryr-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. FKBP1A increase the folding of proteins and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
FKPB1A Human Recombinant fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain purified through a Ni2+-affinity chromatography followed by gel filtration.
| UniProt Protein Function: | FKBP12: an immunophilin and peptidyl-prolyl cis-trans isomerase that binds to the immunosuppressant drugs FK506 (a.k.a. tacrolimus or Fujimycin) and rapamycin (a.k.a. Sirolimus). The FKBP12/rapamycin complex binds NFAT transcription factors and inhibits the induction of T cell genes including IL-2, IL-3, IL-4, TNF-alpha and GM-CSF. FK506 is used in treating patients after organ transplant and those suffering from autoimmune disorders. The immunosuppressant activity of FKBP12 is not apparently related to its prolyl isomerase activity. The FKBP12/rapamycin complex inhibits the mammalian target of rapamycin (mTOR) pathway by directly binding the mTOR Complex1 (mTORC1). mTORC1 contains Raptor, mLST8, and PRAS40, and interacts with DEPTOR, which inhibits its activity. mTOR, a S/T protein kinase, is a central regulator of cellular growth and metabolism. Its inhibition enhances the dependence on aerobic glycolysis in leukemic cells. |
| UniProt Protein Details: | Protein type:EC 5.2.1.8; Isomerase Chromosomal Location of Human Ortholog: 20p13 Cellular Component: endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; membrane; cytoplasm; nerve terminal; Z disc; cytosol Molecular Function:signal transducer activity; protein binding; FK506 binding; enzyme binding; protein homodimerization activity; peptidyl-prolyl cis-trans isomerase activity; activin binding; macrolide binding; calcium channel inhibitor activity; Hsp70 protein binding; SMAD binding; transforming growth factor beta receptor binding Biological Process: heart morphogenesis; protein maturation via protein folding; protein peptidyl-prolyl isomerization; protein folding; positive regulation of protein binding; T cell activation; response to caffeine; T cell proliferation; regulation of protein localization; negative regulation of protein amino acid phosphorylation; muscle contraction; transforming growth factor beta receptor signaling pathway; negative regulation of release of sequestered calcium ion into cytosol; fibril organization and biogenesis; ventricular cardiac muscle morphogenesis; protein refolding; response to iron ion; regulation of immune response; positive regulation of I-kappaB kinase/NF-kappaB cascade; cytokine and chemokine mediated signaling pathway; regulation of activin receptor signaling pathway; SMAD protein complex assembly; negative regulation of protein phosphatase type 2B activity; 'de novo' protein folding; positive regulation of protein ubiquitination; release of sequestered calcium ion into cytosol |
| NCBI Summary: | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008] |
| UniProt Code: | P62942 |
| NCBI GenInfo Identifier: | 51702264 |
| NCBI Gene ID: | 2280 |
| NCBI Accession: | P62942.2 |
| UniProt Related Accession: | P62942 |
| Molecular Weight: | |
| NCBI Full Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
| NCBI Synonym Full Names: | FKBP prolyl isomerase 1A |
| NCBI Official Symbol: | FKBP1A�� |
| NCBI Official Synonym Symbols: | FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A�� |
| NCBI Protein Information: | peptidyl-prolyl cis-trans isomerase FKBP1A |
| UniProt Protein Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
| UniProt Synonym Protein Names: | 12 kDa FK506-binding protein; 12 kDa FKBP; FKBP-12; Calstabin-1; FK506-binding protein 1A; FKBP-1A; Immunophilin FKBP12; Rotamase |
| UniProt Gene Name: | FKBP1A�� |
| UniProt Entry Name: | FKB1A_HUMAN |
Related Products
Human FK506 Binding Protein 1A (FKBP1A) ELISA Kit
Human Recombinant Protein S100P Recombinant Protein (His Tag) (RPES6517)
