Description
Product Name: | Human Eotaxin 2 Recombinant Protein |
Product Code: | RPPB1127 |
Size: | 20µg |
Species: | Human |
Target: | Eotaxin 2 |
Synonyms: | C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. |
Solubility: | It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA |
Biological Activity: | The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg. |
Eotaxin-2, also called MPIF2 & Ckb6, is a novel CC chemokine produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Furthermore, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which includes C-terminal truncation, contains 78 amino acids (92 amino acids for the mouse homolog, without C-terminal truncation).CCL24 functions as a chemotactic chemokine for resting t-lymphocytes, and eosinophils. CCL24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line and binds to CCR3.
CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques.
UniProt Protein Function: | CCL24: Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3. Belongs to the intercrine beta (chemokine CC) family. |
UniProt Protein Details: | Protein type:Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide Chromosomal Location of Human Ortholog: 7q11.23 Cellular Component: extracellular space Molecular Function:chemokine activity Biological Process: cytoskeleton organization and biogenesis; chemotaxis; signal transduction; regulation of cell shape; positive regulation of angiogenesis; positive regulation of actin filament polymerization; cell-cell signaling; eosinophil chemotaxis; immune response; positive regulation of endothelial cell proliferation; inflammatory response; positive regulation of inflammatory response; positive regulation of cell migration |
NCBI Summary: | This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq, Jul 2008] |
UniProt Code: | O00175 |
NCBI GenInfo Identifier: | 6920081 |
NCBI Gene ID: | 6369 |
NCBI Accession: | O00175.2 |
UniProt Related Accession: | O00175 |
Molecular Weight: | |
NCBI Full Name: | C-C motif chemokine 24 |
NCBI Synonym Full Names: | C-C motif chemokine ligand 24 |
NCBI Official Symbol: | CCL24�� |
NCBI Official Synonym Symbols: | Ckb-6; MPIF2; MPIF-2; SCYA24�� |
NCBI Protein Information: | C-C motif chemokine 24 |
UniProt Protein Name: | C-C motif chemokine 24 |
UniProt Synonym Protein Names: | CK-beta-6; Eosinophil chemotactic protein 2; Eotaxin-2; Myeloid progenitor inhibitory factor 2; MPIF-2; Small-inducible cytokine A24 |
Protein Family: | C-C motif chemokine |
UniProt Gene Name: | CCL24�� |
UniProt Entry Name: | CCL24_HUMAN |