Human CD14 Recombinant Protein (RPPB3005)
- SKU:
- RPPB3005
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P08571
- Research Area:
- CD Antigens
Description
| Product Name: | Human CD14 Recombinant Protein |
| Product Code: | RPPB3005 |
| Size: | 50µg |
| Species: | Human |
| Target: | CD14 |
| Synonyms: | Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14. |
| Source: | HEK293 Cells |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | CD14 was lyophilized from a 0.2 �M filtered solution of 20mM PB and 150mM NaCl, PH 7.4. |
| Solubility: | It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 �g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Amino Acid Sequence: | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH |
CD14 (also known lipopolysaccharide (LPS) receptor) is expressed strongly on monocytes and macrophage and weakly on the surface of neutrophils. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a high affinity receptor for complexes of LPS and LPS binding protein (LBP). Soluble CD14, also binding to LPS, acts at physiological concentration as an LPS agonist and has, at higher concentrations, an LPS antagonizing effect in cell activation. CD14 has been shown to bind apoptotic cells.
CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
| UniProt Protein Function: | CD14: Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. |
| UniProt Protein Details: | Protein type:Membrane protein, GPI anchor Cellular Component: anchored to external side of plasma membrane; extracellular space; cell surface; membrane; plasma membrane; lipopolysaccharide receptor complex; lipid raft; external side of plasma membrane Molecular Function:lipopolysaccharide binding Biological Process: response to bacterium; immune system process; response to molecule of bacterial origin; innate immune response; positive regulation of endocytosis; positive regulation of tumor necrosis factor production; inflammatory response; positive regulation of cytokine secretion |
| NCBI Summary: | This gene encodes a protein that plays an important role in the innate immune response and is expressed in monocyte/macrophage cells. This gene product acts as a co-receptor that binds several microbial and fungal molecules, including lipopolysaccharides (LPS). This proteins LPS-binding activity is enhanced by the LPS binding protein (LBP) to allow binding to the TLR4-MD-2 co-receptor complex. The product of this gene is found in two forms, either as a soluble protein or attached to the cell surface by a glycosylphosphatidylinositol anchor. [provided by RefSeq, Jul 2014] |
| UniProt Code: | P08571 |
| NCBI GenInfo Identifier: | 6753332 |
| NCBI Gene ID: | 12475 |
| NCBI Accession: | NP_033971.1 |
| UniProt Related Accession: | P10810 |
| Molecular Weight: | |
| NCBI Full Name: | monocyte differentiation antigen CD14 |
| NCBI Synonym Full Names: | CD14 antigen |
| NCBI Official Symbol: | Cd14�� |
| NCBI Protein Information: | monocyte differentiation antigen CD14 |
| UniProt Protein Name: | Monocyte differentiation antigen CD14 |
| UniProt Synonym Protein Names: | Myeloid cell-specific leucine-rich glycoprotein; CD_antigen: CD14 |
| Protein Family: | Monocyte differentiation antigen |
| UniProt Gene Name: | Cd14�� |
| UniProt Entry Name: | CD14_MOUSE |
Related Products
