Actin (plant specific) Rabbit Polyclonal Antibody (CABC053)
- SKU:
- CABC053
Frequently bought together:
Description
| Product Name: | Actin (plant specific) Rabbit Polyclonal Antibody |
| SKU: | CABC053 |
| Size: | 100uL |
| Isotype: | IgG1 |
| Host Species: | Rabbit |
| Reactivity: | Widely Range,Oryza sativa |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of Actin(Plant Specific)(NP_190236.1). |
| Sequence: | MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP |
| Tested Applications: | WB |
| Recommended Dilution: | WB,1:1000 - 1:5000 |
| Synonyms: | ACT12; Actin(Plant Specific) |
| Positive Sample: | Oryza sativa |
| Conjugate: | Unconjugated |
| Cellular Localization: | Cytoplasm, Cytoskeleton |
| Calculated MW: | 45kDa |
| Observed MW: | 45kDa |
Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
| Purification Method: | Affinity purification |
| Storage Buffer: | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
 | Western blot analysis of lysates from Oryza sativa using plant actin Rabbit pAb(AC053) at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:(ECL Basic Kit (AbGn00020)).Exposure time: 180s. |
Related Products
Actin (Plant Specific) Monoclonal Antibody (CAB23959)
$167 - $731
PKM2-specific Rabbit Polyclonal Antibody (CAB18799)
$167 - $503
PKM1-specific Rabbit Polyclonal Antibody (CAB18800)
$167 - $503
Plant-actin Antibody (PACO00085)
$323
Anti-Plant actin Antibody (MACO0091)
$323
α-Smooth Muscle Actin (ACTA2) Rabbit Polyclonal Antibody (CAB1011)
$167 - $503
α-Smooth Muscle Actin (ACTA2) Rabbit Polyclonal Antibody (CAB7248)
$167 - $503